PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C007148P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family M-type_MADS
Protein Properties Length: 299aa    MW: 33120.9 Da    PI: 8.4654
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C007148P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF58.58.6e-192674149
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                    k+i n+  r +tfskRr gi KKA+EL +LC+aev v++fs+ gk + +
  MELO3C007148P1 26 KKIVNEDDRLITFSKRRSGIYKKASELATLCGAEVGVVVFSPAGKPFSF 74
                    6789999*************************************97776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004326.3E-291877IPR002100Transcription factor, MADS-box
PROSITE profilePS5006624.3061878IPR002100Transcription factor, MADS-box
CDDcd002654.69E-301987No hitNo description
SuperFamilySSF554553.27E-251994IPR002100Transcription factor, MADS-box
PRINTSPR004046.4E-192040IPR002100Transcription factor, MADS-box
PfamPF003199.0E-232774IPR002100Transcription factor, MADS-box
PRINTSPR004046.4E-194055IPR002100Transcription factor, MADS-box
PRINTSPR004046.4E-195576IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MDSSTPIAPV ASNKKQTKGR QKIEMKKIVN EDDRLITFSK RRSGIYKKAS ELATLCGAEV  60
GVVVFSPAGK PFSFAHPCIE TIANKFLNDK NKKNKGNKDD NNNNDDSSSS SNNNSNNKIS  120
INNNAAHPLV EAHRRVRINE LNQQHNQLLS QLDAEKEKGK ALEKLKKVRG NGRGWWETPT  180
EELGIDELQE VDASFGEIYS NVCHQLKQRG VIGCCSYNNY NNNITNSPMG FTTNDQLGEE  240
TIPFNILAGN VPPPLFPPPP PPYLPPHPHF DYGENNNNNN KQQINSSSSN NILILIQS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818750.0LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007.
GenBankLN7132620.0LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008439651.11e-151PREDICTED: LOW QUALITY PROTEIN: agamous-like MADS-box protein AGL61
TrEMBLA0A0A0KNT71e-133A0A0A0KNT7_CUCSA; Uncharacterized protein
STRINGPOPTR_0004s13590.13e-61(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12833331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.12e-26AGAMOUS-like 61